arginase-1 long peptide vaccine

A peptide cancer vaccine comprised of a long peptide, amino acid 169 through 206 (ISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRL), obtained from arginase-1, with potential immunomodulating and antineoplastic activities. Upon vaccination, the arginase-1 long peptide vaccine may activate the immune system to induce a cytotoxic T lymphocytes (CTLs)-mediated immune response against arginase-1-expressing cells. Arginase-1 is expressed by some cancer cells and by immune inhibitory cells, such as myeloid-derived suppressor cells (MDSCs) and tumor-associated macrophages (TAMs); its expression is associated with poor prognosis.