Skip to main content
An official website of the United States government
Government Funding Lapse
Because of a lapse in government funding, the information on this website may not be up to date, transactions submitted via the website may not be processed, and the agency may not be able to respond to inquiries until appropriations are enacted.

The NIH Clinical Center (the research hospital of NIH) is open. For more details about its operating status, please visit cc.nih.gov.

Updates regarding government operating status and resumption of normal operations can be found at opm.gov.

arginase-1 long peptide vaccine

A peptide cancer vaccine comprised of a long peptide, amino acid 169 through 206 (ISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRL), obtained from arginase-1, with potential immunomodulating and antineoplastic activities. Upon vaccination, the arginase-1 long peptide vaccine may activate the immune system to induce a cytotoxic T lymphocytes (CTLs)-mediated immune response against arginase-1-expressing cells. Arginase-1 is expressed by some cancer cells and by immune inhibitory cells, such as myeloid-derived suppressor cells (MDSCs) and tumor-associated macrophages (TAMs); its expression is associated with poor prognosis.
Synonym:ARG-1 peptide vaccine
ARGLong2
ArgLong2(169-206) peptide vaccine
Search NCI's Drug Dictionary